PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG447800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 206aa    MW: 21411.3 Da    PI: 9.8365
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG447800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC81.29.3e-26137181145
                  WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                          ++epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr rsrk++e+
  Pavir.1KG447800.1.p 137 EPEPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKPVEA 181
                          69****************************************985 PP

2QLQ53.57.3e-1971107137
                  QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                          sa+T +Q q+L++Q+l+y+y+aa++PvP +L+++i+k
  Pavir.1KG447800.1.p  71 SALTFMQQQELEHQVLIYRYFAAGAPVPVHLVLPIWK 107
                          799*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.5E-671107IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.22572107IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.6E-1172106IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.701137181IPR014977WRC domain
PfamPF088792.7E-21138180IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MADDKETDPP QPPAKLPRLS GADTSGGEVT MAASSPLVLG LGLGLGAGGG GGERDAEAAS  60
AASMAAAKRA SALTFMQQQE LEHQVLIYRY FAAGAPVPVH LVLPIWKSVA ASSFGPQRFP  120
SLMGLGSLCF DYRSSMEPEP GRCRRTDGKK WRCSRDVVPG HKYCERHVHR GRGRSRKPVE  180
AASAAAPTPT AAAAAVSSTS SRGGAP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278570.0KJ727857.1 Zea mays clone pUT5948 GRF transcription factor (GRF9) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677414.11e-105PREDICTED: growth-regulating factor isoform X1
SwissprotQ6EPP92e-94GRF10_ORYSJ; Growth-regulating factor 10
TrEMBLK7TZB51e-105K7TZB5_MAIZE; GRF transcription factor
STRINGSi018252m1e-104(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62213051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.14e-36growth-regulating factor 3